2IMGAPSX@@@ 8L2C)pJJJJ IH(ȱH:=IH[H`@HcH  $ +   I/H`JLNGȄBȄF aK  haaFF  mJm# KKJ UJ )J ۈ) ;J3ȱJFȱJGJKaȄM  aaNNJFLGJL L? &PRODOS `DaElH$?EGvѶK+`L HHLy XP LM ŠϠĠӠS)*+,+`F)) (*=GJFjJJA QE'+ '== `@ STSP8QSS8 m P o R(8RLnSOS BOOT 1.1 SOS.KERNEL SOS KRNLI/O ERRORFILE 'SOS.KERNEL' NOT FOUND%INVALID KERNEL FILE: xةw,@  ȱlmi8#)!) >dLԡm#i㰼m#iЕOLԡȱfg hi !dLԡ憦  Ljmkm l y`2 Lԡ8(Je稽)ʈ@LULTRAMACROS' @&PRODOS }< v8 .INSTALL.SYSTEM(;:r- -$(ULTRA.20c3)+ $+(ULTRA.30~(7 2  -+TO.COMPILER8&'!++,TO.MACRO.OPT'" !" ,TO.UTILITIES|" !" ,TO.CLIPBOARDt ! %NOTES4e,#x,$,JEM.PRODUCTS =!-- /MACROS.FROM.SMW"p !~!.MACROS.PRINTER* !~!.MACROS.SPECIAL4 !.~!./PROGRAMMERTASKS?!!)ADDRESSESB !7!7PHONE.CALLSD!6}!6,MACRO.0.MEMOF !}p!,TO.HELP.V3.0M;+$!$,TO.HELP.V2.0d $+!$++TASK.SAMPLEl& {& )READ.THISp&4{&4FILES.FOR.V3.00t&+&FILES.FOR.V2.00&&INSTALL.SYSTEMu;:r(,  (L !C_" %k"l" (#M8( % ) L*"m"n" (_7, )7(P0 ( @X p 8  u"!_"f"0 ~&f"0 %o"p" (,) &q"r" ( %L*")0I0hx H( + %Щ ߩu"L! )L! 8'  )ɀ)4,- U JNT) u"Ls"t" ( !` ^"M)Fi/ b"3   !"#$%&h"i"j" e" iL X>"L;"ίΠ`v""""""*$ Fk%YeQP!/RB}QBiBB}\ }FEL,#> ȏ6 . ) ɘ"    L:#:#ŠϠĠԠ  m# m# J Qڨ)̰}] нȱ ̀𩠙 i V N c ɘ\   VG+ #X ɛL ' 0% '8 Jm ʈ0  0ŠϠĠ͢Š͠͠ϠŠŠϠĠخ͠ ͍B B(8`=YYZLYLYLY뿭` 8!@8` %MNЩUMߩ  L 5   8 0 8  `0 / X& & +&&7&P^&0`ŠӠֱǭԠŠҬî̠ӠĮʎ1|&… (n}&Dž (\%Tz&Lc()8= (J 8'z&'{& 3((ʎ1|&|&|&3223 ')L&18|&"m11 2H22h2舌|&|&12H)M0 h10200I20h2 (`LE%12 `_'"L  <8# ȱ)ɀ  )( ` (Xp< @( )m((.(( M(i  ``) |'(j21 z& {&!` ({&z&(i({&(( CBDFGE (r&$ 3(,}&r& … 3(ŅL&JJJJ`Ϡ'8`r&h)hrȱȱȱȱ0]cȱeem*ȱ*ȱ**ȱ**ȱ* )* * )L(`L?* *Ll) ) L( )Ll)8e` ,$`ee` `* G** c*` v* G* c*`hh8`8`***`}*`e`H)hJJ*0JJ)` (< ( < *? ( < (? ( < (? ( <*? * **? *? *? ( < *? ( <.<ʆ>,=?BC8 é&'112`HB-9F 3"aɿ LLB Nϰ H  @h( L Lj  @`eLJCAB@=?<>=?<>CAB@?A` 1 L  <>`ڢF]PL8i m L   6< L  BLRAM' hLDLآ <B*IBGF08Lé'+8H <,``h(`@ڍL3hh@ihAiH(ؠȱ@JJJJq@)@qvȱ@Hȱ@Ah@@cqe J) LL LJiB LJ) BxNhHHHHL(  ްƠx@BEOD  ް(`( C)CJJJl`B g-`J,~@~@}J@` ߩ%S @ ~`E hhhߺ0 h ߐ( ߐ ߐ  0 HϭߍLпllllhh8` Q)T'P#) ɺiL? )?      `l@Hȱ@IױHXATȱH ɯȩ׍̎5H)/@a)_ .0 :A[8@`,뎎׮Б` L ` @>O)I38 I`aם`K8`@Nȱ@O@ IiNȽבN)/ȩ/N`@[ WHJjjjhA D'KI؍0JHi 뎁`C8` @ 3N@) K莭 ⭪i`0 ]; 뮁ٝ٘ 0 W,0 .H hȑNWȮّNW8`ٍّNΨ0NN` G8`F@ 0 H LK8`6 7I8`FHGH hGhF܌ բFܽܕF芝ܝ 밶67 8܅I m9IHHyHȘI Lܝ` @_@ g@Ю׍O)mיOʈ@mȱ@_ȱ@iklbJtKuO)5OI0ܢܽ eL'A* 7`aFG (CD Lz܅IN mAIH` pm mI0LM AOHJFKG 밳JK 밨C%܈@" T)Ii)܍N*܍A'ܮ( 4 䭐 $H %HFFHGHG 됬`R8`)` AHO` 'Q'܅IHHOOЍO@`8 ` ͉% ΉQ8`܅I `L܍MN h8D`F` alH)HFȍJHGK $%܍&܍!ܢ8* J8` L ܝ:)I 'ܝ6`B8iNFLGM`B܅IH3H ( )ȱHΨ`Ί8AeHI SB60I ٙGٙEFJCʈ h猪`8m0`,0H hi PȽΨhٍ0GF8yאFG  $0 K01 E8`1ݺ00 ] 0ʩ 谼 谷`12)1`0`Ȏi 0U`)8`Ψ` W |G 4A)H ܝʈh٭0٭)ܝ٭*ܝ٥F٥G٭'ܝ٭(ܝ`)َ 8ʈ` 0ٝ)i `8`R ꍌvw zNمFمG < Ό0 FGL鮁0 ٭w٭vٽ8`H8`  ,v w 8` vw `ٽJJJJ`H͌hn)NjNjNjN. GH͌ z;٭ *Nۙ۰ڙک `Z8` G# ,`w .w .w .w8۰*Jv۩ ٰvw`JJJJ;i z묁͖ zٍ0  `H8` `ٍyٍiB0H0FG h0`FG `ϩBxED0C ް(`(8`ؑ@`M8`8@ؐʈI묂)v8vv L} LةC8`؍)@ i)v8vyJ ^ ؅F Ls) +%J(a .FإGؐ.` .JHIH IL3FHGI ҭJjHIHB>IؙJJ [: IL}HIHI`JKJK`FHIG ( Ȣ؝}؈JL)eKM`)` J vJ͛ $0 ΊJFJL8`JGBJ T FإG`BH TFإG`,H hHB؅F  ؅GxDE؍00C ް(`(8` zL+J  :"L zH  : 9ؙ` @ P8`K8`B8` H؈OJJJJحm) ) )Ю ЪG `F $ ᭔ع+ؠ 6H  Rh8` 䮁ٽ ٬ؠ@` ( H )8`)i п` H h)N$% LL L L 6 &pJ덟 )@።NJOK 6iKKΞΞ IJΟ JФ̭JjHFIH HIGxKE ް((H hH h8`8@ȭ@L6쬂8NNO 8 ؍JL`RΞʱLN1MOMEKP/MEKΞL;L-M O,p莝eNNO(`JNKOL 6/ &P L8 } [ؑJ`L@ȱ@ `@Nȱ@O`؝}}vIvؐ` jzؽ}؝v j ) j؝zv؈` ` H Th)N@ ;; L  6$ )bJ ] ) H 8hL )  )حJjIwHIvH؊ PLKΞʱNLMO MЈMEKݸP%MEKΞL( O, PeNNO J(` C  7 2JvHIwHI؊ LI  .` A Hv ع Hw ؙ؊ؠIhHIhH  iع `  عiعi` )؍0CGHFHBFGx ް(8hFhG`@4͔ L @Ai ׭2` . R#ع؍0 ]讁)`.@+ i 8` L )߹0 )p )@ ) ȩ ؝H0JK 방 LMJKFG 嬂؍b؍c؝d ؝_ vO) vO )حI͖ z`H@h`h``N8`  ) ;⬂Ȣ؝z@zݚ@ʈLJ KIJHȢݚ h魚)Jn 8 δ ؍ ؍ \H8 ع)ꭱJJJJ Ȣ؝I؈ 6h(8H = h(8Hh(`ؑ@`@ȱ@ ` B@8ZO h鮁ٍٍٍoHٍn8bhcOJJJJO)O@` %I -m) 0@O)N8` @LL =@ /ȹP8` i` =ם0 /B =)( ȹ`8m8m@8` G8`F Pm)@N8`O)@J /טyרםOO)׍O`a 밑 LȹL@ȅH@IL,0` G קּ= ]H.m)N 0 H`aO)@LP8` \᮰ ֩OCDC z L䬁yٙ٭yٙ٩`K GE`FaG 6%&N    ܮ `J HH hh` 0 @ LGL r`̴Yܝ ݝ0̴ȩFG   0` ܅F݅G ` { rͬ 밽܅F݅G ` {* r% L`L뮰HH hFhG܍ݍ 8 `FHGH  hGhF`ݹܙ݊`@Bɼ>K@J5 {9X(K {XXK تKo`V8`no` D on {I9XX`)HJJJh`OeNeO࿰ {9XАO`@ȭ@` ON aNJKO`HхhꭋILhH),fx8 (8` ԍ`@Ae J m00[roIIJK,-NOPQRSu' @   !"#$Ԡ͠(C)1983-87APPLELKL`BLL ެެެެެެެެެެެެެެެ(C)APPLE'83xLLM Mh@8nЍLޭ 0J @,,LRP׽8H  ): e: y8鰕:Jjjj<)yאi8i;i(*=>hPם8`;Zx3QZYXXWV[HEVhEhH)IWHPHHHAHHHLaVEWLӿ`` ֽ ְ& .Vӈ  JJJJH 8h Ei 8EX`'8`jӍWӥC)p> pӥCYӍY 轊( ( ӈBV ( ӭp0 \BkJ ՠ@iӦ> Ӑi'j:ZH i@ioZZH h ѐȭnWǥBJ Ӱ8XӦ>` Ր+>*L o % ԽYӍZӭoӝY 3Ѡ шNZ`rZLkӭZӍq8r7IZӐiZkӐk 8 ѹs ӭq ѹ| kн Z)*>>` @ $(,048<@DHLPTX\`dh 0ުlptx| 0($ p,&"op8`kkV꽌ɪɖxlӽ*kӽ-kәmMlӈ 꽌ɪ`8` ZԍsԍԍԍԥDEԌ8TԌ8WpԌqԠ 7I꽌ɪ꽌ɭ蠪:љVE:8`]ѾV]H)]ѾV]ҙ)]ѾT]ҙ)] >8hUD` ԝY`> Hh݌(`HCJJJJ)*h`8LխӅ:HhHh Ո թ թ ՘VYҪҦ>:Y)Ң`;R?AJ;<ȰY)Ң`Y?)Ң`ȐҰ ;HhHh=Ң`Hh `Hh`DEiȍ0֌18V%֌&8V֌֠)HV)hH)hHIhդD?DRIDQD)҅; ?JDQD]ՎՎՎ`MY pӭY)p  ӭp`C)`BFGV 8`` 9 oXύX012)0120 X F)?i/  O O ] \ + L# L$0)Ħ 0ei G ?橭 ) Ƨƨn  Т V b  u LLJR/H XLw u  u ʆ L   u ɉɛɈɋɕɊɍحa0ӭL  bȱ 蝀 0Lm '    hLW(L $ ]` L  `$ i [  0 ] bȱ ]L]`ºԠōκԠō` 0h)ύh0HHHH " ׍hhhhhhh .hh8`JIMJAYKERRY&MIKELX 0 I . X 2 N+LO. "_ Í *0 3 2 r0 L3 cX 3 2 4 Z+ 4 ɛL   A.L 2L  8 Z+ 8  ɛL  L L! 2J  j6 Z+ j6 ɛL  J  &fL  C!L A.L !` |#  2 F J N+ɛɍ $ K) ح Ω ( L{!J ` 2K  7 Z+ 7  ɛ8` K ` |&L! 2I  6 Z+ 6 ɛL  I  &fL')*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a! |&L! $L! #*L! )L! F"L! ) (L! A.L! 2M  q: Z+ q: ɛ` M 2N  ; Z+ ; ɛLF" N 2O  < Z+ < ɛLm" O  2 f? "L"Q 2 @ #L|#  Q  $ ɛ8` Q `Q 0 1 -- / +F * @ N+ 2L#  @/A` @/A`8` 2P  f> Z+ f> ɛ  `L" P L# 2 ?  R  $ ɛ  R  LA$L|#R 2 @0 1 --@ /A +) * @ N+ 2L# @/ALA$L|# 2 KA Z+ KA ɛL|# KA \h/ Ml B N+ `H 2h b+HLM B BB eB B C N+` N+LA$ lC Z+ lC  ɛɍ` Y` 2 L% F !F  S  $ ɛ  S L% d8` F ^F  --/  +. * * A N+ 2L@% L%L$ F F F N+ɍɛ  d8`L%L%S <+ XJX F F I N+L$ [JX' (ERL & F 0GL% F zG Z+ G  ɛL% L & F F I +S <+ XJX #ZJX# F FJX(  ?ILt& ILt& ILt& $I N+ d` N+ d8` 2 uJ J  T  $ ɛ  T L&` uJ K  U  $ ɛ  U L&L&T <+ XGXHU <+ XhGX uJ J UK N+` uJ J K N+ɍɛL&L' uJ JT U  XLL%' L N+ɍɛL&L6'KXRXLY'T U  uJ J L N+ɍ uJ J 0O 1[JXL'T U  uJ J L N+ɍKX ' ɛ: dL' uJ J OOKX 1[JX KXRX uJ J oOL' uJ J OL' uJ JJX+ OL' O N+ d`U <+ XJX uJ J I N+` [JX-' (ER+ uJ J OOHX #ZHXJX4` uJ !MLS( uJ qM Z+ M  ɛ8`  uJ J OOL'/(//Q  / /L(  - 2W  e? Z+ e? ɛ  )L(  K)(/ Q  ` 2O  7P Z+ 7P  ɛ8` O  2 f? "LF) 2 @ #LK) 2 nP P N+ɛ  L)8`ɍ P\" fR N+ d ʭ   8`L) a fRL) :n   / &R N+ d(` 2 T0 1 -- / +6 * @ N+ 2L) ff xe TL* oT N+` 2V  3U Z+ 3U  ɛ` V  2 V "Lk* 2 9VQ #Q  e]L* ] 2 V ^ k_ W _ W N+ k` Uɯ  D=   ɯ !       `8` ɯ`8`ȱɯ΀)a8 `8 ! 9X" :X``ɛ@ɍ<ɱɺ) (&Ɋ i ɋĭ 8  ` A   @ , ɛL,ɍL,ɈLK,ɕL,Lr,əLV,۰ɺɮ  00     -L+  L+     L+    -L+   -L+ L+8`` -- -L,    -` - --- - -J   L-  ߙ -L, r- `hh +. +.J  `.x. +. T I) THH`hhȱȱȱH2.hJ  `.x. +. T 2.N4. 2.>4.,3. ,4. )`@8@2. I) МTiiHH4.``@.P8@.J` 2 W N+ɍ` eY.((((PPPP..0)00".0.`8` ULTRAMACROS -  - -㩠䬠 -㩠`i././ TO.UTILITIES TO.MACRO.OPT TO.CLIPBOARD TO.COMPILER TO.HELP.V3.0 TO.HELP.V2.0 `Ϯ Ϯ//0@q0q0 00$0%0q0`.L10ߍ r-00O -Z -O_0VW r-000O -ZVW:0L r-00L -L:VW_ 11 -ZVW_ -LZVW_ 11 1 -ZVW:J1ߍ r-J1J1L -L:VW_ -Z -O_1VW r-111O1L r-11O`11  r- r-111O11 r- r-M111`22 222 2 - r-., -宠` r-22P`2 `ԠӠˠŠҠî    F 3F r-33 `L3  P >3P r->3>3 ` - - 4 .` -"3 3 233 3L3033`hh` 7 >9 5  B25 11E  A 3 243 943 3 i34:4 - -34:434 if4m4 g4 n4 - -f4m4f4 ` - - - 㩠 4 - 󠭠 -  - 堭 4 -L5 - ontinue with the imeut installation   -L6 - uit ` 6 -i6 Y66Z66 6`7777Q7f7777 6 -77i6 6666 6䩶77`777 -$ 4i6 6` i6 r-6i6i6` - -  -  - -󮠠 -L; - -  - 嬠 -٠ -󮠠嬠 -堢㢮  - LD: - utomatic   - Lp: - anual ` - -  -  - - -  - L; - es   - L; - o ` - -  -  - -L; - -  - 묠 - Ӡ - -  - L'> - lot and rive   - ӠLe> - ro pathname ` - -  - 묠 - Ӡ - -L=` M - -`` - -` - Ӡ = -󮠠 fE`` -Ӡ -䮠 fE` - 宠` - 宠` - R   DLAP8@JA r-@ -   4 - ` -䮠` - LWC - LWC r-B LWC%ɯϠ򮠠 - 쮠LWC - 䮠򠳮 - !`    CD DD 8 ! WDkD" OD" 8 ! *D r-CD A %.LC*D?DLC. i  +DD,DD   r-  CDLC`nDDDDDDnDDGDZD 렱련렳렵렵렳렳렵bEcE8 ! WD" OD" 8 ! eE.LCEeE?DLCE.i +D`E,DaE r-` 4 - -Ӡ -` -! 4 2` - ` - `S & D -  -  r- '` -  -` - 纠䠯)  r- 3LG - 纠Ӡ -  -뮠 -졠 - % - LH - ormat a different disk  ) - LI - estroy the contents anyway ` -箮` -&宠` - " - ԠLI -LI - -!` -  - 󮠠맮L8L - 4 2`T ( D - U ( D - ` -  - 0` -  - 1` -  -` -  - - -` - ` - -` -  -` - 纠䠯)  r- 9LM - 纠Ӡ -  - -졠 - ) - LN - se a different backup disk  ) - L/O - estroy the contents anyway ` - 뮮` - 뮮` - 宠` - "LO - "LO r-O  -纠 -` 1 -L<`  -LP` 4 4 4` S 6 -LP` - Q   Q   D` EQ@QIQAQ 5.CQ r-`@ SYX/ YXQLlQQQm.mQ 5.QmQQm.Q r-Q r-., r-QLR S  -`` S  -`` -` S 7 -䮠``H ShD E F: + -LS -LSHILfS - 9 -L-S - 3 . -`+LS 0 -έLS - -` -򮠠LS 2` - -宠 fE` - 䮠` b% - 䮠`+ r-O `HI' - 쮠`G( - ` r-B ` - -  - 嬠 -  - -L= -Ӡ - fE` - -` - -. - -" -, -<` -嬠` -쮠`3. r-3.` r-oe`H 2h T` - - -  4`TO. fXX) XN:X:X)pJJJJ9X XJX0 CX! DX" EX1 FX2 GX A  XiX`(`8` Y 8XBX` Y 8X=X`9X :X LX8X12)LX(LY2)GXLYj9X :X LeY !)KYY )GXBFG8XC ;X() ()  L/ |9}# ^!|_!|||45 | i N l R5k  0LT L'!` Main Menu l LM Wؾ e 3 |:} O| Q` B$ ŵ嵢'ie u报|ȐƩ9} 0Hh" ;}<}Lû7}8} ϼL89} B|| |! ϼ N W9}8 輰E9} 輰<9} |^!|_!  l! a!b!L! ^ ZЛ`;Place TimeOut application disk in drive and press Return. R-N ! N ! N ! N ! N ! I-55`U H%T H!`f l| |g|i|hC|D|: 96} Ŭ6)i/ b j z (L]$0 b к!` ` Ȝ`$0t!u! ʤ` ̢`!U H%T H!` 㽦 ʠ_Le` 㽦 | ʠ |LT 1 T iv; i< V ` |i||`| Ji 4Ƹ8JiH Ɗh ѽ ѽ ѽ 㽌8Je oʾ:}Ⱦ DȾ ~` TimeOut Menu TimeOutReview/Add/Changex :(`+L!'L!i08` $6JJJJ6 ƏN$`)p##**LSׅکP$ # :LdөЭ iԩѥѮ# ##L cLL L"%%L# j# ѥ#H# #h` \I꽌ɪVɭսɖ0սɖ!ɖ 꽌ɪ\8`꽌ɪɖ۽*ݽ%ݙEۈзЮ꽌ɪФ`76$\8$9867I$i$88 8 K :9 W :8н :$)* 77` ݌HhHh V ꩖݌$ ݌ `Hh݌`80^݌Hh  ݌ - - -   EEHJНh , - - -`HJН݌h Hh݌`8`0($ p,&"!֠LsԮ# L# .ҥҭ"%&8  Hh# j<ԥ/8`# j# ع&0 &`%8`" %# j%8`  $LhL #8 é%'?BC ,L󠠠㮠H hH ߢ* h `bdefghijklmnopqrstuvwxyz{|DdCd8 Ed><?= @ʎ&+Lf5 < 0//#T' {}a|4%v ,,<(=BЅCQZ6=P H協Z莓 H占Z莟,, LZiZ[i[`1<=>?BC ,NROS 05FōH(Ju4444444F ,,8$9%: *Z"#Ъ芍ЍhȱЍЍiЭdЭA&ѭB+ѭ<JЭ=JЭ\D֍r]E֍s`߭a߭b߭c߭^R_S-.ȱ8 xݍ8 PQ ?ȩBȱC#<=(>? ,ȱ iB CC)<=0>? ,,L , [Lp! d!J   S eCӮӻAPLWORKS.SYS/Ȣ􈌀 Ȁ` ʀߩ ̀` L 0a `H*h`hɛ#`/ *-.`L L(`(`HH *hh  &L $ L H` EL ` t&+`  xx< xx=  (+(c+3)'+ ((h+e+8)5)(g+7)%+'+`ȅ 0"   '+ (+,&+`H'+ '+(+hLL"#"`"#"`v֍T/ RЍw֎( ׭vUw֦Lm*Lѭ @װЍ Юb0)LmӢ`KLLѩ,Jѭ&1(' 'ӽH %ӽ*ӽ8)h0Z% ,/r0j,֭JигЮhh`---..А. n0* `/+Ӯ ݠ(' a0).`*x`* ֍y֮K0Z LL^L.Lw,Lz"Lɐ*L|'L'+L=L $ ,Lѭ. 7Le L] Э#(ɛx")+,Ll,) +ɓ+"&Ƀ @0ɜLɒ б"ɑ б"  Lɝ/)L # LɄ  & ЩLҩx Юb0 )" SLҍKѪ "LҊ ֑"") )  )KL]G) ' iL # LѪ*` 7LR)+LUӬ* `HНН8(' h`*ܠ` n   Gխ'1 ֍'ލy0P 0LLѠ  'Lrӈ(ީY"# , Lԍ֢ȎՌ  ֊ ֩. բ o Gխ $Р"#΢Ρ   $%Lɝ"#8$"%#8"#8$$%% L $"%#'ޑ$ y׭(ޑ$ yש$ y $ yש$ yש$'LLѥ% $`` "',.=+^ ll ,Ġ l l l`.թ߮ ՠPU \ \(`HhȍT` ֠ ֮ U   A %ޮ 5$0`)$%%  ֠ а ֠ `ȍT` ɝ  б"`y 0 ׭`'0 Щ""$#% 瘍'`)` Х()"(`a{)`a a0b0I ,b a0$-,J hhhhLhha0`0T"#`.-` T*"y $ ,*8``$%`*LɽT k : n;  rݍ rݍ rݍ   Lə ,LɆɂ )ޮMLɅ Ʌ ɔ LɌ9 )ޭ L٪ ʊ]ةT, Lɚ )ޭ ! )ޠ Lɑɨɔɧ Ѝy $ , `Lɫ ) Lɥ )ޭح Lɖb )ޮʎ )ޮʎ )ީ8 )ީ3 t*Lɏ Ъʎ-.  ЍLɓ$ Ѝ )ޭ) )ޭ)LɤLHɩ L Lɞ `Lɭɰ l 0 LɎɘ xLɡLɗ |k gɁ |ʊ Z~Vɻ |@L[`B @ɺ |`3)10+/LLɦ +LLɪ$ +/ ̱! ! 7ܝ!GGP )LɼLoɾLɇQ Lɀ,w֎(`*HN hL x m+,mDۅL  \ ۢ"LӢ hh) #LeҢ(` xhh+,LѮ ` 7ܝ'` r t+ '  mꪽi꽗꽖 t 7ܙ .` .  @`)_` ܬk { }~` P* 0-? L P%   LBad Name  i`ꨩ `Hh0` t" /. 7ܝȹ ``L ! !! l`JanuarFebruarMarcApriMaJunJulAugusSeptembeOctobeNovembeDecembe䠠, 1900 o es YN,ȱ"(0:L] " nߐ `߰$ ޭ= `ߐ  `  =Lް ` `߰  ߐ  Lޭ= -/&*(mmLG8LGߢE  "+ n߰& L=<>+ -/*`8` /+L#&(2%7)<LX[AL8` L JJJJJJL m !L mmL mlL [ A  X ! ` ߭mlʎn` ߭ ! llʎl`Hhɀ x Ѝ L)` m )ޭ-l(8mllll`8A L 8A `` :` Щ`HJJJJ h) 0:i` 8rᨥ!v!v r ! ϥ  0ș`d ',z Ќ$ 2 x "$: Lll ": L ߭ ! 9L! mlȥ lkml ": Эz9  +ll T $mL`  ߠ  Ѝ Ѝꌐ ꍂ ꍁ ꍃ "' gL`㢅MI'ɣA9ɰ1Ϡɭ)%ɟ!ɢ-ɧɫɽ L p䬐 llP l "+ L c䭁 ꭂ ꭃ = `ߐ  `l l  z ȹl  L n*<*{ )ޭH* =h( Gծ{*`k  rݍlP{l. l& lLlP ̅ m` )ޭ )ޮʊ t )ޢl謡  @)lPl` !& ( ȹmlL lm( l` ll l `8 !81  ! iQ !`"' lʎl`"` -L婘 ݅!0 0*˅ ݅!0) !  ! 0 r) rȩ l0mm ޭ ޠȹޝml` 0ml`, l"#Lэ Ta   p 8 smt r T:l謒0 Tlʭm nml`l 8 Hi0lhLZi0l`,橠ލڠmȌ+,mm̅L Тvz{֭{+,{Lь{֍zֱ"Lӭ) "#`) +&ޠ`) "#&ލ+ РG)`"" k Ȍ猭 l U )Lȹl, 0`)PTl lvm` `HIUh T` UT`'ޢ ɀɠ ``l !+,rȱ 0/:+)υ*,)+ &) &)e++)e,,+&,+e*+,L3+,` ɛ)$荤 `8` ӻ l l ] M i 8Ѝ  l  lc MLXY K`0 L >  ӻ WĻLa0) N? ` & 'ި`Record a Macro v֍U?T` ӻ΄0j4i4<5=w  Ѐ x. Ѝ4n5ow 8턾LIIБ 0Q  @װ0P ΄0( Ѐ żżi伢w 0ө ЀL8rrFfL  0`0Go Chargers ' Default macros installed. ': YZY>X=YZYX,X=X=.A B Date: ' From: N JEM SOFTWARE P.O. Box 20920 El Cajon, CA 92021 To: CCN DT FTFGM254 HCA1 IIN 3 J JEM SOFTWARE P.O. Box 20920 El Cajon, CA 92021K PLUJ LELMSM 254 N 3 NHeather BrandtOIN 0 P PA ٜ' P1 1 ٜ' Q RO τ S4 UFYT  T ZT"move to the clipboard": "jump to the end and do it":9 Y--B -E +B +E C C-C CXYY=}+XZ=YX=Y=X=X+Y=Y+0=XYZ0:/NP / C= C= AppleWorks.Sincerely, N  ĕ 5 0="PathFinder"0=' Requires "PathFinder" from JEM SOFTWARE ': ' Choose a drive ': 5 ' Choose subdirectory ': ONP s 5 2  3 ^ "":ڭ8=0 9=0љ0="Phone Calls" ڹy' 8: 9: = F' Go to first cell and press Return ':WX1=" "+3=" First cell:"+1+' Go to last cell and press Return '3:YZ2=U=W=YU=X=ZU=U=3=1+" and "+2+" are in different rows and columns "3:U=V=Y-W+V=Z-X+V:V=V-V= "":U= 6 y3 y1Q=T 2ќQ: 3 ' " = + 4"this is text and so is this":Y=T әX=T X=Ydate date2 time back ahead del find tab esc rtn left right down up spc clear uc lc insert zoom read store recall bell 1=0Z=)12=1X=%22+" = ":X: Z=Z-1=1ZZ>Y=' Enter date in this format: 01/30/87 ':0=L=)0L=" Invalid date; press a key ":"":Y=Y+X=%0YXL=L-0=0LL>" The new date is "+:"":0="Macro Compiler"Z=0+" not found": NBY=j*+iZ= X=j*+iX=YZ= Z=L )&V3.0K é%&?BC ,I<&=H>)?BC , )G?BC ,<.=>/?B0C8 é<)=>.?B C8 é)<)=ƅ>)?BC8  I<)=>)?BC ,B/ /c cy   L}󠠠㮠H hH ߢ* h `""""`󠱺pq dzL*  DLU z ^J_`Ja)6 ,,L'' !! qU"# Gܩ$%$$%u!!( 'L!!ᵭ!⵩͍!! 8  #$L%& @!! !!1!!!!"^{ !,L ,p [L" "   S eӮӻAPLWORKS.SYS /  ` `  ` z` 0 0xx 0xx 0 0|uz wzy}vz`ȅ 0   zH |`z`Hz z|GhLL7LLضL  `  ڍ` `Err  oC  L q tu`L%)( Ѝ`U`a0)aЎ/0T Ljߍ Lq̭qܠ`  l (` 9ֶնHЍIЍHЩIТLHЭIL Recording !^ 0 ``T|z zH vw8xh0"v U(`}b { |z Ƭx`}Lw^H_a8|z h`` Lͷ  * ` "#L*эLL  <LŵHh`T ` L L  * LŵA w l  l  y 4ys l l l FG 6 LzU gLU HI(T Hq(`U HI(T Hq(` Ȏ 9ꍷ w  ;ЍsLb l g W~ y +T ]8 N(D EFG `U (` "',.=+^FGE D`TR0"A"4)4)4 F4 4A"L=AA05iἍ꼢wI Ixƍ FA TA0( I6i67wI0ӭU`H0Q0 = N  H0P`Record a macroSelect macro key: Replace global macro xx8Ff撍 ` A @J)I/J l I, ` L EL l `J Hf UЀf ` RЀ Hf`> LH / l d 8  l HHՍH /!b D!H `V3.0 iUH $%HH H[ /!IR z"HH HI HJT"#"#""#"# cq D!HL` uRv!we ߩZ Х8S  %!  ЍSm!S u L.ty 0  Z y ` \0!) l M 9)`)@ l % l ) l 3  9 l `ERRORNA `G LG HLH p` `  Zy,0a0) ` D ` ԍ`L7LnLLLLgL(LILI"#"`"#"`܎L :` (Щ` Lm *ې qLʠ uԭ LТ0``q`q 0\  LL^L.L,LɐqL'LU"LC+Lk=L} !5u Z L Э&()ͬ"prsLlsp rɓr"&Ƀ pLV L*ɜLɒ (б" (б"  L*Ѣ ɄK"H#H gh#h"$э ( (  Ц& gܭ   g  멀Lɝy (y, b0&,0! )" LLҍ EL,Ҋ ""p p pLp  bL L*Ѫq` qL*э0P0LLbԩT"# ! LӍ rgb Yǥ"#   $%Lɝ"#H8$"%#8"#8$$%% Lҥ$"%#$ 뭸$ 멝$ $ $ $LХ%DА $CА`` ɝ  Р"` 0p ӭ`0 Щ""$#% uԩ`B ` Х( )"(`L-% !q``a a0b05  ,b0a0-,) 8`a0`, @,)LǷ, ,)LqLcə jLɆɂ@ g܅L  g% E%஡ELLL LɖT gܦʎ gܦʎ gܩ8 gܩ3 L gܥp gܥqLɤ LɽQ ߮k 7 r z IЅ IЅ IЅ    LɌ8 gܥ L]ت ʊשT, Lɚ#H gܥ ! ghɚ  Lɨɧ Ѝ ! L] g L gܢ` άLɥ gܥץ Lɏ Ъʎtu  ЍL" Ѝ gܥ) gܥ)橀L  ¾ zL s L c L  xL L ߢ `ɩ Lɞ cLɭɰ Q  m0 nLɎLɘ GLɡŮ`ɗ m iɁ ʊ \~Xɻ AK[G Eɺ a8{4 c10+ /La|Lɦ Lɪ,! ʠ/ ̱! ! ۝!P )LɼLɾLɇLɀ``qHN hLٍ   (L٭s  W   rs *څL巭 ͪл ` (  l - ڢ"LҢ U ݪ ` Whh rsL*ѢU ͪhh L ک 뮩hhLѩ` U ` ۝ ʎ`H*hLg  mL'ۢ I ڠL@ ɠ/   @ ۙU  OʈU `ɀ . @ c` o0 7Q 0 L۩? L Aȱ  0 n  B L٭ ` r ֽE z0 n ` ! !! l`,ȱ"(0:L ꮦ E ݐ ݰ$ ܭ= ݐ  ` ꮰ =Lܰ ߭` O ݰ ݐ ( (Lܭ= -/*eeL|8L| r/ Ln HH zhh EЍ+ ݰ& L =<>+ -/*`8` O3#!Z&L%( %%#3)&L[AL8` * IL * L * LJJJJJJL (H hLoo [ A  ޥ ! eެo ! eިL! IЭ` ` ݥ  ʎ` ݥ B  ʎ `Hhɀ  Ѕ L)` g r! 澍־ߍ``, Ќ$ 2 # E$: La߮ 莮 E: L ݥ ! L߬! ( ȥ ( E: ЭA ( {3 T $  L``  ݠ  Ѝ Ѝ  " %&' jL=PLH@w8Qɰ0mɭ(ɟ FɢXɧnɫɽ 挶 L -謐  P  E+ L; 譁  = ݐ  n`   7 ߅ȹ  L r and so is this":Y=T әX=T X=Ydate date2 time back ahead del find tab esc rtn left right down up spc clear uc lc insert zoom read store recall bell 1=0Z=)12=1X=%22+" = ":X: Z=Z-1=1ZZ>0="Macro Compiler" Z=0+" not found": Z ZV=ڙY=XZ= ڂX=YZ= Z=V L: L< L Jd[X NLJ> L J Me! L MLH  M! dY NLHd JLH!d M L JLH Mə MLlJɜLJddX N"Y NdY N )do LLHdɆɂ L MLH ɤɩ IKLlJɽ L J L L J LLlJɖ L N L N L N L NLlJ& L nL LdY N L N: L NLlJɧɏ1 Ld JɧY N L nLLlJɞXY NLlJɚ L N L NLlJ L MLoJɨ% ɥɌ L N MLH n | | &n`  n QL(X 抱` `ddZ K$dH d\ L̸\h @ L d8`d d #K L d`$K%K #K8`œd` #K` T셊Td` J$ L Jd$d L$d nK` N J: J` J" %&')d L Jdd%&), @ LdL Ldh` J O H L: Lh` d JA d N L J L dLnK L J L (N J O8`` J0,ALLd J J JH Jh) N`ddY Nd& LL(NdؠY Nd!# L J NLL Kd( d #K L d`dNN DNdȹ L`H$ Lh( L J L)`=<>+ -/*`8` o\d ~\d)  ~\d)  @ Lddʎd ]L;  W]dG dB' POYd ] 2РO^O ^O NLZG d Gq " cdd m oH^ oV^ dC$d|8 mb|c|i8LJP VLP Vd̠\ ?V  QL X U{ܠ{ cRX *Ke mee Vd \ ?VL`W{D{ cWX7e o\ ~]d] ?V {VL`Wd֠\ ?VL X d d Ue{ c< a:< ySe(LRP) c ddm a:LRPm Oem5Qdd5]L#V "',.=+^ a{<d a [X *U ]L#V md W m W d{ͤ^ d WLRPd5>dd aLkSd }d{d cLQ<H ah(d ^{d ySe($LNS cSLkSF W& ƊƉddd W WLARɐɤ ɩ cLuQLkS a \RLuQLkSdZ *UQgd W{$Z cU W( aI c W a> ^9, ^0dd ^L"SY *U W ^L"SX *U LSLLSY *Uɭ{$' cX( W aL cH ^C) ^:hLSP b/ W ^%+?d ad` W ^L\R8` cA[ a gcdLuQI]L Vmmem a{< {- ' c>m a a-mL$T{ cALU{ c dOB dSLT d W a c>dZ *U( ]L#V{ c dH ^h`d8`dZ *U4Y *U1 bLT d W ^Y *U U W ULTLkSY *U W ^d`X *U5ɽKɏ= WX *Uɞ--Y *U bY *UuX *U H Wh`8`LULkS W ^ ya W ^, ^ yaH ^hLT ^ _dd ad(`mUUm d U dm8`m)U Um U# c m{ 8 c m0- a aLYU{ c#,$mɐ ^$ > UЈdmɀ {@8`)H ^h`m{8`dZ`{){d2Ȍ{{ o {{ Q d ] ?VL4V`Șb]d ?Vd  CX Ud0 cL`WeVfVUV\Ve| o ] o ] o\ UVe|` l]8Nn D  ~`ii  ]L#V n: n׭{){{  { m l{ l{ m {`ddm ddd CXmd` dd\ ?V VEƊƉ 折抩 CX U"#$%LWdT o\d G QL Xa| d|8b|c| b|b|c|d|q U"#pq  ~ML(X NGHGH` Dd o `STARTENDalladbawpaspasrprint^findpo find,back.ahead"date2'date+time24=time!!firstlastuclcbellclsinsertzoomreaddiskpathstorerecallincdecbeginendifelseoffendmacroelsenosleepclearifkeyifnotifandorinputrptstopthenexitmsgremmenu&launchonerrposncellgotowakechr$str$getstrscreen!key)len(val%asc#id#atoffpr#waitdisplaygetvarputvarkeytocalljsr&peekwordpeekmsgxypokewordpokehilightmidleft tab down up rtnrightesc spcdelctrl-Akeycurhorcurver8dirsortU filecountT openfilel filestatusR kbtypefreememsocursorcurschar9dbselrecs dbzoom!dbfields"dbrecs$dbrpts݅dbrules{wpwaa|wpzoomccwidthcolwidthsspzoom3workstrworktypeworkvalfalseofftrueonexitflagyearmonthdayhourminute·tclock˷dclock1keypadpmsghqmsgvrwaitkeysvarsettmenuhelpumenuhorvmenuincwmenufirst Working...Compiling macro ctrl-ba- No errors No start Original macros unchangedThe macro table is fullStopped by EscapeIncorrect application nameReserved macro name Syntax error Logic errorString too longNot enough parametersToo many parametersError , but "END" was found in Line Compile MacrosDisplay MacrosPause each line Compile from BeginningCursorCompile a new set of macrosDisplay current macro set Bytes used: 0Max bytes : 4009This macro set is locked;"you are not allowed to examine it.! a"{0:?{ a{ ` ^= ><d` _d,dd dd d _ed Wd0d Wdd Wd ^+ -/* W ^$L^d ^ , ^ dL^ ^,`]L Vmr]L VddɌWSOKGCɥ?; c62ɰ.*&dɚdɟ dɖd`d{#L a$L`d[ةY *U: W`d$ Y *U8 c mV]L V WLc{ ^!mY *U c W ^mL^8m`&` a(0:`8`a{)_`: `LG u Z u Z 0 N`@GhGhGHGH@GLNL[G  |iL |iL` C[ WDZ   o [ o [  QLG o Yaa BG I;W { n I J'LI NLGbG  _ I ILIaɀ)H< Khb a KL'H!H< Kh JL#H K> K: K< K IaDW MLI> K I Mb! K LLLG  L aPX MLMHa JLMH!a M K Lə -MLIɜLIaaW M"\X MaX M )ao KLMHaɆɂ K -MLMHɤɩ JLIɽ K I K K I KLIɖ K [M K [M K [M K [MLIɓ& K K KaX M K [M: K [MLIɧɏ1 Ka Iɧ\X M K KLIɞWX MLIɚ K [M K [MLIɨɫɥɌ K [M MLMH n | | &n`  n QLW 抱` `aҠX dJ$aHa(Y K'Yh @ Ka8`aa J Ka`JJ J8`œa` J` Y녊Ya` I$ K Ia"a K"a J` [M J: I` I"'a K I KaLpKaҠX M K I $N K K lMLpKaɀPX MFa)W M8aaiX M K lMaɟ K lM K lMLpKaA $N K J, INA[ K ILmK K I KLJ J: I` Ia^W M sɀ)bLKaɐ J`H Ka K- Kh! JLK K a`, K {G`#a abaʽ{7` <a LLaa7`{a#a a`{ n% oL  L |͆L |ͅL QhhLWLI&Insufficient memory to list the macrosr} _  _LLа n _ |8 | | |8`Ha <a Kh`Ha > Kah` J IN H K: Kh` a IA a $N K I K aLJ K I K lM J IN8`` I0,ALKa I I IH Ih) N`aaX M a KLlMaX Ma# K I $NLK dJa(a J Ka`a ! aȹ K`H$ Kh( K I K)`=<>+ -/*`8` oYa ~-Ya)  ~'Ya)  @ Laaʎa ZL; C[  W5Z NYa Z 2NZNZN NLG a* " `aa m BG oZ oZ aC$d|8 mb|c|i8L|Orr ULIO Ua;Y 9U  QLV T{ܠ{ _;W JA[ mbb Ua1Y 9ULLV{D{ _@W7A[ o1Y ~ZaZ 9U uULLVaEY 9ULV a a TA[{ _< ]:< sRb(LO) _ aam ]:LOm ]N@[mgPaaYLU "',.=+^ ]{<a ] DW )T YLUma Um U a{B[ ULOa8>aa ]LeRa }a{a: LQ<H ]h(a [{a sRb($LHR _%LeR Uɐ ɤɩ _LPLeR Y^ _QLPLeRҩX )TMga U{$Z _U U( ]I _ U ]> [9, [0aa [L!RiX )T U [L!RW )T LRLFRPX )Tɭ{$' _S( U ]G _H ]>> ]5hLRP ^* U [ +a ]a` U [L_Q8` _A[ Y^ ]_aLPYLUmmbm ]{< {-*: >߬m ] ]-mL$S{ _ALT{ _ aOB aSLS a U ]: >ҩX )T( ZLU{ _ aH [h`a8`ҩX )T4\X )T1 ^LS a U [X )T T U TLSLeRX )T U [a`W )T5ɽKɏ= UW )Tɞ--\X )T ^X )T^W )T H Uh`8`LTLeR U [ ] U [, [ ]H [hLS [ \aa ]a(`mTTma Ta8`m T _ m{ _ m3- ] ]LIT{:' #,$mɐ [$ > TИamɀ{)H [h`m{8`X`{){aCȌ{{{ ^{ o {{ Q a wY 9UL.U`ȘѠYa 9Ua  ,W Ta0 `LLV_U`UOUVUe| o 1Z o 3Z o1Y OUe|` l'Z8rrNn D  ~`ii  wYLU n* n׭{){ m l{ l{ m {`aam aaa ,Wma` aa_Y 9U [EƊƉ 折抩 ,W Z"#$%LVaY oEYa QLVa| d|8b|c|r b|rb|c|d|* Z"#)*  LLW NGHGH` Da o `STARTENDalladbawpaspatoprint^findpo find,back.ahead"date2'date+time24=time!!uclcbellinsertzoomreaddiskpathstorerecallincdecbeginelseoffelsenosleepclearifkeyifnotifinputrptstopthen&msgremonerrposncellkeygotowakechr$str$getstrscreenkey)len(val%asc#id#atoffpr#waitcallpeekpokehilightleft tab down up rtnrightesc spcdelctrl-A Working...Compiling macro ctrl-ba- No errors No start Original macros unchangedThe macro table is fullStopped by EscapeIncorrect application nameReserved macro name Syntax error Logic errorString too longNot enough parametersToo many parametersError , but "END" was found in Line Compile MacrosDisplay Macros+TimeOut UltraMacros must be installed firstPause each line Compile from BeginningCursorCompile a new set of macrosDisplay current macro set Bytes used: 0Max bytes : 4260This macro set is locked;"you are not allowed to examine it.!k   o v[ o [ hhLQ  o [L[[`Macro Compiler requiresa Word Processor file.Get IN the file first! ]{ ` [= >< a` |\ a, aaaaa \ea Ua0a Uaa Ua [+ -/* U [$L[ a [ , [aL[ [,`YLUmYLU aaɌ:ɫ6ɥ2.*ɣ&ɰ" aɚ aɟ aɖ a`a{$L`]aTX )T6d#` U{$X _SD U ]Ia ]A)=a _LC]X )T ' UL\{ ]L]<a ]a`8` && ]D _I0 iZL] ] ]*)υ & &ee&eΩaaaaaaa a`8`0:a _A[8`ȹ{{`ba mbm{ m{ mb U T mȹ{ mmb` mab8` aaɆ ɂ Uaa a( U ]* _a ]a U [ U=aə [`8`"'8`^a U!a ] U!a!aFLUaL[` a Ua a sRb aa( ) _ a`ma$ U U [ _Q%aaa ƊƉ U ]_ {:>: U`a$X )T6 mŠYLU UL_{ [ mX )T  U [mL[8m` ](0:`8``{)_`r}` _ Ѝ`` H7`````` H7` H``````DISPLAY MACROS OPTION #Insert Return before each new macro 9 L! &D Macro Options ' <pΏp8 p,,zj{jA_! _!z_!0H51ɭ. 0$T "L0` K`"L` o " LQw! x! w!0` Disk error t!"u!"8z!t!"{!u!" 9 ȥ"'"""" ε" ʫ" ̳"` 2" ZŢ `!0+TimeOut UltraMacros must be installed first! < uf uf u f sR s`Df u fR6Df u fR ЅЅDg u g u(g u0g 0zj >nL` N` ````  ` NL`Fbbc``a^ea66zj` W(g s o =a o fa LQL ` Lzj`(The clock routine has been replaced; use(the original ULTRA.SYSTEM to restore it. W(g ЍaaЍaa&Ѝ` W0g  uAg uRg u lgDRg u gD0Rg ugDRg ug ug 0` 6b0b7b1b  /b NLacdd+dd'eFe Wf  j nh l  l8 l Lb l 0ohLbp j 0oh LQ _o 0`H hʠ Bmpmpbb l  v 0oh HH H NhhL` j 0ohLQ Wfrj l` inh  L c l^h |j_h/ j ^h ~p 'k Hq Lsc kG7 'k2 iq@ kY"rjqqqq ~k 0ohLc 0oh jLQ 0o,f o=fLc Wg |j k Gk 0ohLc 0o~h jLQ WAg oi o iܠ {e oj o ?jݠL{e Wg Id{ {ewj{` Wg Iddzzj`d dLd`ddȅƛ0 륛d |LNdhh o h LQ Wlg Id o \i ~;i ~Oi{j^ {e o \i ~Fi ~Oi {j` {e{jLo W(g s!eʈzj` W(g莟zj` Wg^ {e` W(g oe o e o fLQeeee{eyjwj o hi Dwj  ~ xi 5wj{j J_LeaLewjyjzj`TimeOut UltraMacros v3.0 Copyright 1987-89 Randy BrandtPublished by Beagle Bros already exists..It's not a Task file, so you can't replace it.Activate auto startup macro exists. Replace itLaunch a new TaskCreate a Task fileSave macro table as default setDeactivate clockDeactivate macro key clickReactivate single-steppingVersionOther ActivitiesSet cursor blinkSet mouse button responseSet mouse responseDeactivate the mouseReactivate Key-LockReactivate screen preserverSet screen preserver delaySet button response Save macrosScreen Preserver%No mice found; look for smiling cats.Type Task file name: Select next Task: ULTRA.SYSTEM updated. created. Launching Unable to update Unable to create Unable to launch There are no Task files on Unable to read Searching 0Insert AppleWorks STARTUP disk and press Return horizontalvertical sensitivity Adjust the Current value: Enter a new value (1-255): $Save current option settings to disk/This is the time OFF for the strikeover cursor,%and the time ON for the insert cursor/This is the time ON for the strikeover cursor, &and the time OFF for the insert cursorSEG.APLWULTR Hs 셛t曥%꥚$查8sjstj$}!%~!` ld8` op` tp` |p` apfphpppup}p` j nh kL6k kkplp gp`rj lf ;`Yrjqqqqxpyp}! q~!qrjqqprp j;vpqwp j,qprp jvpswpsjxptjyp j` 0of f ;`ujDG  i  Z `uj` l 6h ~ ]A 8Х  ^l ԩ` l L:l 1 . ./0: )A[ f ``tu -l l` w l` 0oh l p l lll lt­t)й%tl&tlpЭpѭlll lLmi'槥ʹlͳl ltLlll𾭯lΰlίlLHm(ejⱦijԱmjЙv)ȑЙv mp 0nLHmЍpэpLlv nH jh iq``*n+n l v 'k`iХi` i ;YLo  kLciqpirp jkplp oحmpxpnpyp jǭzs^s`s{s ,ss^sR s sLn s sLʎ s6ʎs jLczjLc`ipsjp gpHipjph` -NoOoUoVo l  o ` pЭpѢ po oʎooo o Lh=oioooЍoэo 0nmo8oo uLo` oT zo`p|o^xx Hp `xx Hp HpoU`HЭoѱЮoo_phL s P(`L V3.0<"=>"?BC , ,,<#=BC!?BC ,    L L%    L  [J S eCͻULTRA.SYSTEM/Ȣ􈌀 Ȁ` ʀߩ ̀`L60 C P -O -   u6 u6 u 7D[!R+7 u *7R э#D=7 u<7 uW7 u_7 0 N 6` 0000  0 NL602330L1A5g1 WW7 5!1͍*1[!I[!1#11$17,11-1L1>#11$1E,11-1 K011 K11` L 0a0a0b WW7 #э9` W_7  up7 u7 u 7D &ӍR7 u 7D Ѝ,R7 u7D ЎR7 u7 u7 0 9 =` 2121  1 NLl1444s45555 W6 V: G< >9L3240 >9 LQ ? 0`H hʠ Bm00m10 x=L3 >8ii9ȱ %9$00 v:п00 >а0莇? 8LQ W6 ;` l8 98/ V: 8 $0 : HA L3 f;GG :B iAS V;Y200 v:#0A000 }: 9 :  >8L3 >8 :LQ >I6 oZ6L3 W"8 9 : : >8L3 >8 :LQ Wp7Le5 W8 4+ s>q4& s>r4Nq4nr4Nq4nr4r4 +э+ e5q49 r4.q4r4.q4q4 +ѭr4&э` W7\!+ &&Ӎ\!9` &Ӎ`hh o ?8 LQ W7 4 o 9 ~j9 ~~99 e5 o 9 ~u9 ~~9 9 e59L? WW7 , Ѝ9` WW7 Ѝ9` W.8Le5 WW7 o5 o 5 o 6 o 6LQ55u5v5 +э99 o 9 D9  ~ 9 5!9 9 JL5ЍL5999`TimeOut UltraMacros v2.3 Copyright 1987 Randy BrandtPublished by Beagle Bros)(UltraMacros 3.0 requires AppleWorks 3.0) already exists..It's not a Task file, so you can't replace it.Activate auto startup macro+TimeOut UltraMacros must be installed first exists. Replace itLaunch a new TaskCreate a Task fileSave macro table as default setDeactivate macrosReactivate single-steppingVersionOther ActivitiesSet cursor blinkSet mouse button responseSet mouse responseDeactivate the mouseReactivate Key-LockReactivate screen preserverSet screen preserver delaySet button response Save macrosScreen Preserver%No mice found; look for smiling cats.Type Task file name: Select next Task: ULTRA.SYSTEM updated. created. Launching Unable to update Unable to create Unable to launch There are no Task files on Unable to read Searching 0Insert AppleWorks STARTUP disk and press Return horizontalvertical sensitivity Adjust the Current value: Enter a new value (1-255): $Save current option settings to diskSEG.APLWULTR 녛C曥%꥚$查89C9$0%0` lLl: ld8` 0` 0` "0` 9 0 0000#0` V: 8 :L: f;00 0`9 6 ;`Y90000 v:K0C09090 }:00000 v:0C0C9C00 }:` >6 6 ;`9DG 99  Z `9` e8 ]A 8Х  ; ۩` , . ./0: )A [ש``de -6< 9 4<` g <<` >.9 l 40 9 .< 3<5<=< <dпd)ж%d <&d <00Э10ѭ < < < <LR=i'槥< < <dL>< < < < < <L<(9ⱦ9Ա9Йf)ȑЙf _=40 =L<Ѝ20э30L><f x=H :h iA``== l f :`iХi` 9 ;Y]  :R00 i= iC= v:00 0 >!0000 > v: }:9L3L3`Ѡ > > > s>50C s>50C\!)IC& s> C+ s> C s>50 C`}>~> `>>>>>iЍ> =i>=i>`0C0 0H00h` ->>>> l  o ` 00Э10Ѣ 40D? 7?ʎ}??? o {8=}?i}???Ѝ?э? =m?8?~? uL??` ?T 'ӎ?@(ӌ?Ѝxx ? Ѝxx ? ??U`HЭ?ѱЮ??@hL`L qTASK ,,<"=BC!?BC , L L-   i ȭ L  [R S eKͻULTRA.SYSTEM/Ȣ􈌀 Ȁ` ʀߩ ̀`Lx! &D Utilities|HH < K{+m!  9LʎM Њ5wG |b,M07wH8wHv% Hvv5w,M0h8wh7w } {jL{  o{ o {L{{  o{  Q`*Getting errors trying to load applications This version of TimeOut does notsupport multiple TimeOut menus||8|vu|v г|v Њ,M&:w L|7wH8wHHH7wH8wH||7w8w ԃ,M0kld|e| H|L|hh Њ||;wFR+I EL~#u~I~ ~L~,~0T)T~ TT0m~iS Q Eu)~~uTu)KuTDuO=u.6vAvv v8vvu)Huh / & % L~ ?v`8`v`Loading new applications:  o~ 0 R}`% `vj  Ш! !)"  o ! ~ o   Q L~v HihLki  % !*  ~ ! ! ! !% ! GЩ ! !v ^!v_!v8vm !攍8vv l !` must be loaded whenAppleWorks starts up.!)` &D8e`vo`vuv Њ ;* CvDv   o QLY  ԃ`%This application is already in memory Њ ;l g  o ( ) 9  8ХG !D l ! #5Dͅ   o E o { QL'j Č ! l ԃ`Change name of: New name: 5Unable to change the name in the TimeOut menu because)the new name is longer than the old name. Њ   Z   `6Press TAB for any other menus, any other key to quit. jHj b! hj`xx.x Њ ;I D   ) ~t ! ~yLS ~ ~  ;Y ! ! #` is MemoryDisk -Resident Change status Њ ;> 悽Cv炽Dv    o QLCvDv ԃ ! ь`&This is not a memory-based application ЊvLʊ vJvivKvLvivM iECEvHvHvHvHGvEvvvvvvvhvhvhvhGvƊƊL ԃ  o Q`The TimeOut menu is now sortedklvv v`H h $ ?(`   ! ?( 8`  RF E ?( 8`! Њ ; { ,L{`{  6  .`! of{ QLb{ M  X{ 0{ {L${  ? ?`1There is nothing to configure in this application ` {т{҂{ l ab C ||||ȱ | }j!gȱ}k!h}l!i {a b !|u`|~~~~~ -_`  o| ) F+ 8&j Cv|Dv| | З|! | $L|H  ?h+ o |L| o | | ;Y`!Unable to access this application(The applications disk is write-protected Try again Updating  o} ~ o} u } u } u} u} 0[uQM> }{ { = ~ ] 8Х+ &u lu aL}  uaa`--> Select file location by:ProDOS pathnameSlot and Drive Pathname: AppleWorks data diskTimeOut applications disk ua`_~ȱa~ l c~ D_~ ~  {~ Da~ ~  ~  a~ /Ѝu_~ L~a`Enter a number between  and :   . `  2м~~~~~ua`YesNo  2~~~~~ua`TrueFalseHȱ 3 H 8Х$ I  ]  ]L~ lu a`Enter a new value: LN 0:lN c 0S:AK[GN 5N cA#["LN cA[L8`3ȱ5 l 7 D3    O D5    U  5 5Ѝu3 La`Enter a number between  and : # g `$ȱȱ oLg `e`6 ˀeȱe66`6 ӂԂȱȱȱ%ȱ&2ȱ8m%1 ii u ; o7 ~ o9`[] @ ȱ }j!gȱ}k!h}l!i F  `#1灭 `:' . l }L l }L  L  M` M` l ` l ~ l ~` l ~ l ~`  l ` IJL l H` . `! j!gk!hl!i8o!j!p!k!MM F #` L HgL׃ȱmgȱmhmi F]|}ab ` #= }j!g}k!h}l!i |H | !|#h | ML׃   (L0ab) Hgbȱ luua` j 憩 ] ZA :ݟɱɺ L H h`a _L8`5Use Up and Down Arrows to scroll, Select with Return i68q ή) E)iiq N` ! چL5 چ Lʆ`  N  N` h8hq `ƫ LLq L ~` چL چ ~` 腢  چ腭    `L oL` ) 憢e撠 چLȑ T o, ` ( | N | ܢ) -$ `ԆنiȆȱ8+Ɇ ن Ԇ   ~ ~Ն ` i`q`ghi F !` 0 5 / > 5Ij/j` Enter Slot: Enter Drive: 1ȌyJJJJ) p l j`Slot X, Drive Xhlhk  oو o u Q u [ u j u { u u u uP * P 07P LjȈ W P ̉ NL Њ9w v^!v_!`{V {Q[j{$TimeOut applications utility optionsATimeOut Utilities Copyright 1987,1988 by Alan Bird (Version 3.0)Q[j{ ConfigureLoad to memoryDump from memoryChange memory status Change name Sort menuAdd applicationsList version numbers 7 WU{ HhVT` m`ns & Ho!os`j Č89 ~`   Hˊ  H ϊj 0H H ˊy P= hϊ j`5w8kl H7w Њj`L ϊ(kߊl v` o )  ;Y`Unable to access Try again}v Ji 4}z{|8zJyzi ~YȌȌqPH >r?s o:  ( :w^ D^ ~) h o`]报H Čh,} zz'imy  ]]P C o ~L? u CvDv * vL8]Y[ :`Select an application tomy` - e 曦 8e Ɲ` _L |L vivv`n!! m!n!m!n! `j v!viv" lv ` Hs!n!`su jsgkshlsi FL덬8osjspsksՍ֍ !\ mimis  !3=L; H!s r!!j r!Cvs!DvL H!s ь8` 9 MRVT^f` -WXYZ U` ]` S` e`uL}! &DData Converter t  < o! K@" l""AL@  o ! o 8" Q`CP AQ *`GGAAi荱AA }AAA K Eȑ UE ELHBE GGMGG 8ȱ0()  ΅ L'Bȱ L'B NB BL:BE GGE0LA ELALR `B)Bȱ)BȢG BB)@8 BB E`G` 8e`GGBBBBiBB }ABB  HP R  E EGE GG)GG C DL(C ^D -EE ELBSR ` EP aEUА  C(26qCrC y CCC Cő CP UEiLNCSR `qȑ`qy)Cy qyLCȹy   qCGGq`\D]D Mȱ $.-\D600:,]D%]D\D̅ =G b c b 8`ȱDȱDȱHȱDȱDh8AD mDDDDDDDD` JanFebMarAprMayJunJulAugSepOctNovDecȱHȱ EȱEhA8A P8 E  E E E` : M%E&E G UE`HEihȑE8e`i`E EEEEqE` aE(EE G  Gy`GGP EQ E`####E{|ȌE EHEH G G z0JEm l ELthe mouse. A fix for IIc mouse users will be available soon. Macros Manual LJLoad the file "Macros Manual" from the UltraMacros disk. It contains many ;sample macros described in the manual, and a few bonuses.p. 31OMMacros SOLID-APPLE-CONTROL-@ and SOLID-APPLE-^ are reserved, but you can use 1the BOTH-APPLE equivalents of these two macros.p. 36PNIf you want each to reset macro 0, put the in another macro and OMcall that macro. A better way to read a character at a time would be to read !the cursor character directly: Nc:! go to end of sentencep. 40JHBug Department: you can't use some literal numbers between a begin/rpt NLsequence. (3.0 users see the 3.0 section). For pre-3.0, the numbers are 17, JHand 37121 through 37375 inclusive. If you must use these numbers, use a OMvariable to represent them inside of any begin/rpt sequences. You might also NLrun into problems if you call a both-apple macro from inside of a begin/rpt sequence.p. 87KIThe Key Chart has 128 possible character codes, each with a low and high JHvalue. The high value is 128 greater than the low value. The high value NLrepresents an OPEN-APPLE command, and the low value represents normal text. CThey're vital for understanding how , and work.p. 79LJThese program disks are for AppleWorks 2.0/2.1 only; for 3.0, you'll need MacroTools 3.0:MKTimeOut MacroTools is sells for $25 including shipping and handling. There KIare five new TimeOut applications on the disk, and over 150k of powerful NLsample macro files. There are even macros to do inserting tabs, decimal tab alignment and much more!NLTimeOut MacroTools II is also $25. It features UltraPublisher, which allows LJmultiple column publishing in the Word Processor. It also offers improved ?mail merge, multiple variable sets, new macro tools and tips.1California residents please add 6.5% sales tax.  Macro Programming Problems KIPlease examine all sample macro files on this disk. Use the OPEN-APPLE-F PNcommand to search for samples of a specific command. You'll learn much faster by doing than reading.MKIf you're having trouble with your own custom macros, please exhaust every PNpossibility before writing. To have me (Randy Brandt) examine your macros for LJwhat might be an UltraMacros problem, send them on a disk to my attention Lalong with a description of the problem and your hardware/software setup.  Special strings LThere are a few features which are unclear or not mentioned in the manual:OM1. String variables can be referenced indirectly by using a numeric variable to specify the string to use:Da:! prints ZERO ONE<b:!PN2. String tokens requiring one parameter can not use equations. The following MKmacro would be illegal because "getstr 3 + 2" should be "getstr 5" or some other single parameter.8a:">!:Parameters for strictly numeric tokens can be equations:<a:! from "Macros Menu" Obscure hacker notes PNAvoid the use of BOTH-APPLE-CONTROL macros inside of any complex macros which Luse begin, rpt, or any of the conditional logic. Weird things will happen!KIIf you're defining chr$ 0 in a string to use with the command, use IG$1-$9 and not $0. String 0 is actually macro 0, and it will ignore any #characters past the first chr$ 0.<  The following notes are for AppleWorks 3.0 users only. KIWARNING! Some tokens have been changed. Delete all of your existing task Dfiles and recompile them with UltraMacros 3.0 before running them. Macro Space -----------MKThe old limit was 4260. To make room for new features, the macro table was MKreduced to 4009. I apologize to those who crammed a macro program into one MKset, but with the new command it should be easy enough to segment MKyour program. Macros are now literally unlimited in length, since KIcan install sets from any disk. Who'll write the first 1 meg UltraMacros program???Screen Preserver----------------MKOn a IIgs, the entire screen (including the border) is changed to black by LJthe screen preserver. Moving the mouse or pressing a key will restore the screen..$35E holds the screen preserver delay value.Clock-----NLA new clock option displays the current time. The format (24 or 12 hour) is MKdetermined by the AppleWorks standard settings. It appears in place of the 8"OA-? for Help" message. Macro Options can disable it.Noise-----PNBecause the cursor now blinks while recording macros or entering , the NLspeaker clicks on each keystroke so you know that a macro is in control. To 5cancel the clicking, use option 5 in Macro Options.IIgs Keypad Bonus-----------------OMIIgs users can run macros without pressing the option key. Extended keyboard LJusers may use their function keys, and standard keyboard users can define MKnumeric keypad keys to act as single key macros. Just use OA-X, and press HFthe desired function key to record. To play the macro back, press the 5function key without worrying about the option key!MKA table in memory from $D031 to D042 holds each numeric keypad key. If the PNentry is changed to a 0, the key will no longer cause a normal keystroke, but 0will call a macro. The table is in this order:HKEY D031: Rtn Ctrl-X * + - . / 0 1 2 3 4 5 6 7 8 9 =HHEX D031: 8D 98 AA AB AD AE AF B0 B1 B2 B3 B4 B5 B6 B7 B8 B9 BDIGLet's say you wanted to enable the keypad 0 to be the same as SA-0 for NLquickly pasting macro 0 into a file. Poke #keypad + 7,0 would activate it, KIand poke #keypad + 7,$B0 would reset the keypad 0 to entering a normal 0 again. Task Files ----------PNULTRA.SYSTEM is now a task file which can be launched by Macro Options or the PNlaunch command in order to restore the user's default macros. There's no need MKfor a DEFAULT.MACROS task file. To restore your default macros using Macro PNOptions, simply press OA-Return while "Launch a new Task" is highlighted. The JHULTRA.SYSTEM pathname will appear. Press Return to restore your default NLmacros, or enter a new task file pathname. From within a macro, use .PNTask files are not compatible with pre-3.0 versions. Pre-3.0 task files won't NLappear on the Macro Options list, and pre-3.0 Ultra users won't see the new PNtask files on their list, either. To convert macros, just load the source and JHcompile with v3.0. Some changes in peek & poke addresses, and the Jcommand might have to be made. Any macros will have to be changed. Compiler --------PNYou may press OA-Return on the Macro Compiler's "Compile a new set of macros" 5option in order to compile with no questions asked.KINumeric variables can be multiple characters; there are still just 26 of MKthem, but you can use any alphanumeric characters after the variable name, PNalong with _, [, and ]. The compiler simply ignores the characters after the name.JExample: can be See macro H in Macro Samples.NLThe compiler now recognizes some AppleWorks addresses and special values by Mname. This is for use with peek, peekword, poke, and pokeword. For example:Ox:!NLAlways follow the label with a space or ">" or the compiler won't recognize KIit as valid: is ok; won't work. The NLcompile won't list the label when decompiling. The address will be given in decimal as always. NLTIP: Just use decompiling for getting to your recorded macros, and then add ?them to your commented source file where everything is clear.IGThe compiler now also allows the use of literal key names to represent LJvalues. Double quotes tell the compiler to use the Open-Apple versions of MKkeys (hi bit on), single quotes mean use the text versions of keys (hi bit 0off), and carets mean control key equivalents.F! when run x = 193, y = 65 and z = 1GThis is handy for things like ;Here's a list of supported labels. Send us your requests!*true 1 handy for logicon 1;false 0 Ex. if x = #true then y = #false+off 0 Ex. display #off<ccwidth width of current spreadsheet cell6colwidths width table for all columns5curhor horizontal cursor position5curschar character under the cursor3curver vertical cursor position+dbfields total categories(dbrecs total records(dbrpts total reports,dbrules are rules active?Gdbselrecs active records (find/rules change the count)&dbzoom zoom statusMKdirsort default is $20 for sorting directories; change to 4$2C to get a file listing in the actual disk orderEexitflag for use with menu and key; see Menu Sample+filecount files on Desktop1filestatus status of current file,freemem K free on Desktop4kbtype type of data on clipboard?key for use with ; see Menu SampleAkeypad exclusion table for auto keypad macros?menuhelp for use with ; see Menu Sample?menuhor for use with ; see Menu Sample?menuinc for use with ; see Menu Sample?menufirst for use with ; see Menu Sample/msgh msg horizontal value,msgv msg vertical lineAopenfile current file's number in Desktop indexCsocursor 1 = strikeover cursor, 0 = insert cursor&sszoom zoom status.varset active variable set-waitkey default for Eworkstr current spreadsheet cell (if string value)Hworktype current spreadsheet cell id <128 means label8workval spreadsheet cell value (SANE)=wpwa length/cr byte for current wp line&wpzoom zoom status New Tokens ----------NLand used with logic. See logic notes following the new  token section. Example:G if x = 1 and $0 = "test" then msg "true" : else msg "false"PNasr replaces and signifies a subroutine macro. Any macro starting F Dwith can only be called from another macro. This is handy for D Bthose dangerous macros you don't want a user to hit accidentally. ? =You can't an macro from a macro called from the E Ckeyboard, only from a macro that was itself called from a previous  macro.JHcls clears the current work area; this is usually lines 3 thru 22 5 except in the data base. For use with msgxy and msgOMdisplay if numeric expression is 0, turns display off, 1 turns it on; note C Athat the command requires the display to be active. While @ >the display is off, Escape can't be used to abort a macro. To C Aignore Escape at other times as well, use $ Ex. display 1, display xAendif same as elseoff; added because Mark Munz asked for it/ Ex. if x = 1 then a = a + 1 : endifFendmacro immediately exits the current macro no matter what follows0 Ex. if x = 27 then endmacro else ...Jexit exits a begin/rpt loop or the current macro if no rpt is foundM Ex. begin : x = key : if x = 27 then exit else print chr$ x : rptNLfirst is just an OA-, and moves the cursor to the first db category, ss @ column or wp column. It's easier to read than oa-, in a macro.OMgetvar restores a complete set of numeric and string variables except for C Anumeric variable A. Ex. to store set 1; use for the number of the active set?jsr same as call; added for whimsical 6502 reasons only Ex. jsr $300PNkeyto is similar to input, but allows you to specify the ending key using @ >the ascii val. It also traps Escape and returns Z set to 0 if A Escape was pressed, or Z set to the ascii value of the last keyMK Ex. would act just like except OA-Return % would end it instead of just ReturnH <$0 = ".":keyto asc $0:if z = 0 then stop else print chr$ z>MKlast is just an OA-. and moves the cursor to the last db category, wp D column or ss column containing data. It's easier to read than oa-.,launch launches the specified task file0 Ex. launch "ultra.system", launch $2PNmenu easily creates AppleWorks numbered menus within a macro; returns in  the result in variable Z( Ex. see the file Menu Sample6mid allows you to extract any part of a stringCA Ex. $1 = mid $3, o, l {o = offset, l = length} If $3 = 0 "UltraMacros", o = 6 and l = 3 then $1 = "Mac"NLmsgxy sets the horizontal and vertical coordinates for the msg command; F Dif the first number is 255, the msg will be centered. Use msg 0,128  to reset it to normal@ Ex. msgxy 66,23 sets msg to overwrite "A-? for Help"NLor used with logic. See logic notes following the new  token section. Example:F if x = 1 or $0 = "test" then msg "true" : else msg "false"=pokeword works just like poke, but stores a two-byte value Ex. pokeword $400,x;peekword works just like peek, but gets a two-byte valueJ Ex. r = peekword #dbrecs { number of records in the data base}GEputvar stores a complete set of numeric (except for A) and string * variables Ex. to store set 1K& user command calls $B900 after evaluating a string; see exampleIf-Then-Else Logic------------------KIand & or are used with and to test multiple equations. Any A ?number of 's or 's may be used. The equations are all  evaluated from left to right.PN With all 's, if any of the equations are true, the final result @ >will be true. With all 's, if any of them are false, the < result will be false. simply reverses the result.GEmixing? Both and may be used in the same E Csequence. The equations are evaluated from left to right, with the E Ccumulative result being 'd or 'd with the current result. D BThis means that the rightmost equation has priority. A final true E C will make the result true regardless of what precedes it, and > a final false will make the result false. For example:@a: 3 or $0 = "test" then sa-x else stop>!NLif $0 = "test" then sa-x will be executed no matter what x and y are. If $0 C Ais not "test", then sa-x will only be executed if x = 1 and y is A greater than 3. Changing x or making y < 4 will stop the macro.Changed Tokens--------------JHSolid-Apple Delete is no longer a reserved macro, since OA-Delete works  everywhere in AppleWorks. OMato is no longer available, having been replaced by . For TimeOut > and the token to take  appropriate action.LJcell works in the SS with all possible labels and values; the actual C Avalue of the cell is returned, not just the displayed value. For E Cexample, if cell A1 contained 3.512 but the formatting was dollars C Awith 2 decimal places it would appear as $3.50, but would  return 3.512.Gdisk can now be called anywhere (no file list has to be visible)NLdate/time now read the clock every time they're accessed; they also use the ? formatting defined by the AppleWorks Standard Settings optionPNfind now automatically sets Z to 0 if it fails, and to 1 if it succeeds. C AIt also automatically searches all TimeOut menus present, and no - longer exits the current macro if it fails.OM Find uses the $0 (macro 0) length in looking at the targets, which E Ccan be any length. You just have to enter the unique letters, not = ;a whole name. For example, if you have three TimeOut menus F Dinstalled and want to use the Thesaurus, press OA-Escape to get the B @TimeOut menu, press OA-0 and enter "th" to define $0, and press F DSA-Rtn. "Thesaurus" will be highlighted and you can press Return to E Crun it (unless you have an application called "Thespian", in which A case you'll need to enter "Thesa" to distinguish between them).N Ex. $0="Macro Compiler" : oa-esc find if z = 0 then stop endif...M This macro would find the compiler no matter what menu it was in.NLkey no longer can be used by itself. You must use an equation such as C A. Old task files will still run properly, but you can't B @compile source files which use as an independent command. E This allowst Control-T to be sent to a printer via the pr# command.OMmsg now defaults to normal text; 'single quotes' still produce inverse 4 messages, but would appear in normal textKI The command now uses an AppleWorks routine (StrWrRtn) to F Dwrite strings, so messages can be placed anywhere on the screen and > time B @expires the default is returned, but if the user presses a key, B @that key is returned. poke #waitkey with the value, and peek it # after the wait to get the result. Some Tips ---------HFHere's a macro to call up the TimeOut menu even when inside a TimeOut application:A:! use SA-Esc instead of OA-Esc tipOMAdd 128 to the vertical line for to get literal screen bytes to the MKbuffer at $900. Normal text will have the high bit set, and MouseText will Mrange from $40 to $5F. Don't try doing a with a string made this way! and